top of page

CircRNA

Gene

chr18|56779430|56816144|+|3|circRNA|WDR7|ENST00000357574.7|17,18,19

WDR7

Open Reading Frame (ORF)

LESHQKPRRLSPRLLMPQGLKQKSRRKSMTLLTMTSPLVGVS

Peptide

KSMTLLTMTSPLVGVS

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page