top of page

CircRNA

Gene

chr18|49863226|49880455|-|7|circRNA|MYO5B|NM_001080467|29,28,27,26,25,24,23

MYO5B

CircRNA UID

circMYO5B(29,28,27,26,25,24,23)

Open Reading Frame (ORF)

MPDQVGLTVKSMLTRRMPLRPITGSARQTASCRPGARKCSLER

Peptide

MPLRPITGSARQTASCRPGAR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page