top of page

CircRNA

Gene

chr18|49163684|49430447|—|13|circRNA|DYM|ENST00000269445.10|14,13,12,11,10,9,8,7,6,5,4,3,2

DYM

Open Reading Frame (ORF)

LLSKKHNKVLEQATQSLRGSLSSNDVPLPDYVVFWKCRFKDKLSA

Peptide

GSLSSNDVPLPDYVVFWKCR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page