top of page

CircRNA

Gene

chr18|48757918|48761689|+|2|circRNA|CTIF|ENST00000256413.7|8,9

CTIF

CircRNA UID

circCTIF(8,9)

Open Reading Frame (ORF)

LRQDGALYGGGDQVPEPAPQHAAGGSRDLRGATSPNSMVTTSQAVPNTTGTTRNPTRGAQHPTPQGGPLTMATARTGAGTMAT

Peptide

GATSPNSMVTTSQAVPNTTGTTRNPTR

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page