top of page

CircRNA

Gene

chr18|46836356|46846841|-|4|circRNA|PIAS2|ENST00000585916.5|9,8,7,6

PIAS2

Open Reading Frame (ORF)

MRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGAMHHRLKMGLNRSALDAP

Peptide

AAYESLILDGAMHHRLK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page