top of page

CircRNA

Gene

chr18|46122466|46124893|+|3|circRNA|HAUS1|ENST00000282058.10|5,6,7

HAUS1

CircRNA UID

circHAUS1(5,6,7)

Open Reading Frame (ORF)

LARLKQQTIPLKKKLESYLDLMPGCQESRVASVYRKGQS

Peptide

KLESYLDLMPGCQESR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page