top of page

CircRNA

Gene

chr18|46088108|46095131|—|5|circRNA|ATP5A1|ENST00000398752.10|6,5,4,3,2

ATP5A1

Open Reading Frame (ORF)

LLLTQSLTRNVSMMDLMKRRSCTVFMLLLVKRDPLLPSW

Peptide

NVSMMDLMKR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page