top of page

CircRNA

Gene

chr18|41987811|42004541|+|6|circRNA|PIK3C3|NM_001308020|4,5,6,7,8,9

PIK3C3

CircRNA UID

circPIK3C3(4,5,6,7,8,9)

Open Reading Frame (ORF)

LGSTSRGQTGLGTSGKMEADGCRGLLGAVILSLHQPNCEALCCCPVATGR

Peptide

LGSTSRGQTGLGTSGK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page