top of page

CircRNA

Gene

chr18|37160199|37173081|+|2|circRNA|KIAA1328|ENST00000592611.5|7,8

KIAA1328

CircRNA UID

circKIAA1328(7,8)

Open Reading Frame (ORF)

MAGCLEHHHLLKSTKTPQTVERIGRRGRQLGFIRI

Peptide

GRQLGFIR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page