top of page

CircRNA

Gene

chr18|37066889|37084232|+|2|circRNA|KIAA1328|ENST00000590617.5|6,7

KIAA1328

CircRNA UID

circKIAA1328(6,7)

Open Reading Frame (ORF)

LFKSRELVAEKQLTKPQELKLDMNGSDSGPRYPVEKALSSVHLWNWMVPT

Peptide

LDMNGSDSGPR

ORF Found in Long-Read

true

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page