top of page

CircRNA

Gene

chr18|36195256|36205276|+|5|circRNA|MOCOS|NM_017947|2,3,4,5,6

MOCOS

CircRNA UID

circMOCOS(2,3,4,5,6)

Open Reading Frame (ORF)

MEPLWCGFTAILSSAALRFRAQSSILMCWMTKGTSLVTPRNCLS

Peptide

MEPLWCGFTAILSSAALR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page