top of page

CircRNA

Gene

chr18|31907459|31913522|—|5|circRNA|TRAPPC8|ENST00000283351.8|9,8,7,6,5

TRAPPC8

Open Reading Frame (ORF)

LTYVFWCSIMIWLTVAIILQRKIFLMIKQCFMQLVP

Peptide

IFLMIKQCFMQLVP

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page