top of page

CircRNA

Gene

chr18|3151693|3215251|-|11|circRNA|MYOM1|ENST00000356443.8|12,11,10,9,8,7,6,5,4,3,2

MYOM1

CircRNA UID

circMYOM1(12,11,10,9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

LIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSGPVPSRGTGCLCLFIRGATSTMISATATRTCAAP

Peptide

GATSTMISATATRTCAAP

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page