top of page

CircRNA

Gene

chr18|26032398|26057742|—|7|circRNA|SS18|ENST00000415083.6|10,9,8,7,6,5,4

SS18

Open Reading Frame (ORF)

MEDIDQHSLDHHSHPSRGLMDMTSHPHRICLWVLEG

Peptide

GLMDMTSHPHR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page