top of page

CircRNA

Gene

chr18|25224344|25227697|-|1|circRNA|ZNF521|NM_001308225|3

ZNF521

CircRNA UID

circZNF521(3)

Open Reading Frame (ORF)

MQSQQQPFPGHGGLYLRVQYDSRFQPLSGQLNHGGSCPANPKESREEEGRSTNP

Peptide

MQSQQQPFPGHGGLYLR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page