top of page

CircRNA

Gene

chr18|24366891|24377535|-|3|circRNA|OSBPL1A|ENST00000319481.7|4,3,2

OSBPL1A

CircRNA UID

circOSBPL1A(4,3,2)

Open Reading Frame (ORF)

MTWETRRFIELPLQDERNEHRSGATASPSRQKWQC

Peptide

SGATASPSR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page