top of page

CircRNA

Gene

chr18|24143090|24143413|+|2|circRNA|CABYR|NM_012189|2,3

CABYR

CircRNA UID

circCABYR(2,3)

Open Reading Frame (ORF)

MDIKDLVKQFHQIKVELQTSCQNDFFKAQTCRTLWPQDSARGN

Peptide

AQTCRTLWPQDSAR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page