top of page

CircRNA

Gene

chr18|22982217|23001729|+|9|circRNA|RBBP8|ENST00000327155.9|7,8,9,10,11,12,13,14,15

RBBP8

CircRNA UID

circRBBP8(7,8,9,10,11,12,13,14,15)

Open Reading Frame (ORF)

MNDSLEDMFDRTTHEEYESCLADSFSQAADEEEELSTATKKLHRMINSIKQLSLNVRKTLFQIHR

Peptide

QLSLNVR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC

NA

Potential Cryptic Translation

false

bottom of page