top of page

CircRNA

Gene

chr18|21366026|21384403|+|3|circRNA|GREB1L|ENST00000584446.5|2,3,4

GREB1L

Open Reading Frame (ORF)

MKWKMMKTMKKCLIQTAHQFPIHKNLPQKDLALQMVHKKL

Peptide

DLALQMVHK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page