top of page

CircRNA

Gene

chr18|14077328|14085076|—|3|circRNA|ZNF519|ENST00000592345.5|4,3,2

ZNF519

Open Reading Frame (ORF)

LQFRGEMMSQDLEPISQNRLPPPTHSGCPDHHFKPTSPAAKKIKRVVQKAKSAREGSILGGTWKSEIVFDHLLWTLSGMVQPE

Peptide

SAREGSILGGTWK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page