top of page

CircRNA

Gene

chr18|12999420|13056698|+|15|circRNA|CEP192|ENST00000589596.5|2,3,4,5,6,7,8,9,10,11,12,13,14,15,16

CEP192

CircRNA UID

circCEP192(2,3,4,5,6,7,8,9,10,11,12,13,14,15,16)

Open Reading Frame (ORF)

LLAVSSVARFLIRPPLKTSVLLFPAAQFTALWLTCRTCLLLCTHS

Peptide

LLAVSSVAR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page