top of page

CircRNA

Gene

chr18|12366964|12371691|-|4|circRNA|AFG3L2|NM_006796|5,4,3,2

AFG3L2

Open Reading Frame (ORF)

LLCSGVESCFTCCSRDPGEKSLGRTLSITIFQKEYFTDLLQLKQGPAEILF

Peptide

TLSITIFQKEYFTDLLQLK

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page