top of page

CircRNA

Gene

chr18|12351084|12363856|—|7|circRNA|AFG3L2|NM_006796|12,11,10,9,8,7,6

AFG3L2

Open Reading Frame (ORF)

LDSTLEKDKLARKLASLTPGFSGRQIGSRQQAFCSSDLYTRKNSC

Peptide

KLASLTPGFSGR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page