top of page

CircRNA

Gene

chr17|8238030|8238629|-|2|circRNA|CTC1|ENST00000315684.12|4,3

CTC1

Open Reading Frame (ORF)

LGPRGWTKWEPPAPRAAVTFRDTNRPIGRLGTRVQERKPLCER

Peptide

WEPPAPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page