top of page

CircRNA

Gene

chr17|82251528|82252433|-|1|ciRNA|CSNK1D|ENST00000398519.9|5

CSNK1D

CircRNA UID

ciCSNK1D(5)

Open Reading Frame (ORF)

LFILTYLPSAHQRGEYLEALERWQARQARASGPQVAGKGWTGSGGASLCSGCPLWPPPGAREISFAFVGLPQDTHLK

Peptide

GEYLEALER

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page