top of page

CircRNA

Gene

chr17|82245975|82253244|—|6|circRNA|CSNK1D|NM_139062|9,8,7,6,5,4

CSNK1D

Open Reading Frame (ORF)

LLVSHRKAALDQSHRIHSFKELHPPGCEARQLPHGPGEEGQPGVHHRLRAGQEVPGCTHPPAHPLS

Peptide

KAALDQSHR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page