top of page

CircRNA

Gene

chr17|81846946|81859387|—|5|circRNA|P4HB|NM_000918|6,5,4,3,2

P4HB

Open Reading Frame (ORF)

LLFLPKSVSDYDGKLSNFKTAAESFKGKMPLGVATARLWPLSMPKPLGS

Peptide

GKMPLGVATAR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page