top of page

CircRNA

Gene

chr17|81604547|81608822|—|3|circRNA|NPLOC4|NM_017921|8,7,6

NPLOC4

Open Reading Frame (ORF)

MWTISCLRITPSLTAFLTSGERQGTSILGTYTDGTRSTKTFPLASGLKWLRFMSHLSHSMRTI

Peptide

WLRFMSHLSHSMR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page