top of page

CircRNA

Gene

chr17|81588943|81608822|-|7|circRNA|NPLOC4|NM_017921|12,11,10,9,8,7,6

NPLOC4

CircRNA UID

circNPLOC4(12,11,10,9,8,7,6)

Open Reading Frame (ORF)

LTTKSTLKGTRCPISVWHWSVMSVCCHARTPRSLATPRSLAVSSTCLMCFISHSMRTI

Peptide

CPISVWHWSVMSVCCHAR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page