top of page

CircRNA

Gene

chr17|81441830|81445681|+|6|circRNA|BAHCC1|ENST00000584436.7|5,6,7,8,9,10

BAHCC1

CircRNA UID

circBAHCC1(5,6,7,8,9,10)

Open Reading Frame (ORF)

MSALPAAPGLAPGCAAPRKRMGRVSSPRPTSSHPNQITSTCATCRPSPRCCRPTTTSPAWPGPPLPTPWAPAAGIETGVRQAPCRRAPRTSTASSWAKSWAERRRARPLRARSGQRQRRTVARSGTSWCCPCQPTGTAGRAAPHPEGPARAAPSTSPPASSTPRCSTARWAGLR

Peptide

AAPSTSPPASSTPR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page