top of page

CircRNA

Gene

chr17|80361733|80368143|+|6|circRNA|RNF213|NM_001256071|39,40,41,42,43,44

RNF213

CircRNA UID

circRNF213(39,40,41,42,43,44)

Open Reading Frame (ORF)

LGFSRAPSAWEMQRTPSVCPATTCTACAASGPGLPQSR

Peptide

TPSVCPATTCTACAASGPGLPQSR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page