top of page

CircRNA

Gene

chr17|80325029|80348286|+|12|circRNA|RNF213|NM_001256071|18,19,20,21,22,23,24,25,26,27,28,29

RNF213

CircRNA UID

circRNF213(18,19,20,21,22,23,24,25,26,27,28,29)

Open Reading Frame (ORF)

LRYARCRGPAERLLAGRVRSGVAVAGVLSQTEAQLLCRFPSGTPAHGRPGAPRHLHRVSDQYPSGVLLL

Peptide

GPAERLLAGR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page