top of page

CircRNA

Gene

chr17|80287814|80295813|+|7|circRNA|RNF213|NM_020954|4,5,6,7,8,9,10

RNF213

CircRNA UID

circRNF213(4,5,6,7,8,9,10)

Open Reading Frame (ORF)

LWQHLKKHVVPLPDGKSTDFLPVDCPVRSKLKTGLIVLFVVEKIELLLEGSLDWLCHLLTSDASSPDEFHRDLSHILGIPQRAKRRKGRRKRRGTSPLPQSWLPCPFLLPAPVT

Peptide

DLSHILGIPQR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page