top of page

CircRNA

Gene

chr17|80263573|80289837|+|5|circRNA|RNF213|NM_020954|2,3,4,5,6

RNF213

Open Reading Frame (ORF)

LRPRPRTRWLLLKKKSVRMNKGSLKTSRSQRGRTEVQLL

Peptide

GRTEVQLL

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page