top of page

CircRNA

Gene

chr17|79944907|79947831|-|2|circRNA|TBC1D16|NM_001271844|6,5

TBC1D16

CircRNA UID

circTBC1D16(6,5)

Open Reading Frame (ORF)

LYLRELLRLTHVRFYQHLVSLGEDGLQMLFCHRWLLLCFKREFPEAEALRIWEACWAHYQEDPAELRRVQPCRRLFPRDVGPGGAHLGRGPG

Peptide

DVGPGGAHLGR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page