top of page

CircRNA

Gene

chr17|7899543|7899890|+|1|ciRNA|CHD3|NM_001005271|15

CHD3

CircRNA UID

ciCHD3(15)

Open Reading Frame (ORF)

LHYHPRDMAGTPRGIHGSVGTGNVGRGLGAMVCNPCLENRVMAPVGSHSQDKVSGSGGVGAWLSGGS

Peptide

DMAGTPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page