top of page

CircRNA

Gene

chr17|75842645|75842856|—|1|ciRNA|UNC13D|ENST00000207549.8|5

UNC13D

Open Reading Frame (ORF)

MGWGPQGASSWLLPLPSQPGPGLLAGAPTSKKPCSAGPPCCWSPSLSPGGGSAPGGGDEGLSQGPSRLREHGVGSPRGFFLAPSSPITAWPRTLGGSTHFQEAL

Peptide

GFFLAPSSPITAWPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page