top of page

CircRNA

Gene

chr17|75611658|75611865|+|1|ciRNA|MYO15B|uc002jom.1|22

MYO15B

CircRNA UID

ciMYO15B(22)

Open Reading Frame (ORF)

LGPCGQGLMARGEGWRWSQGQVPHLDAPGLRESCWCPLVRTPSPVPLLWGVSVPCGSSL

Peptide

LGPCGQGLMARGEGWR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page