top of page

CircRNA

Gene

chr17|75486426|75487040|+|1|ciRNA|KIAA0195|ENST00000314256.11|5

KIAA0195

CircRNA UID

ciKIAA0195(5)

Open Reading Frame (ORF)

LKFSRSSPSCLVYCAGRHGKVGRHTCRNWGGVGAGSLRWSSPAPKGRGVAWISAWPFIQAVFMKLGCGLRVVEALLRDGGSCCPGACGAVGEAAPTHETFLQQVRSRAGILVGKDDRTYQSPEGSPPAPQHRRVACGQHCRGSCHLGS

Peptide

AGILVGK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page