top of page

CircRNA

Gene

chr17|74439744|74443912|+|2|circRNA|GPRC5C|ENST00000392627.5|2,3

GPRC5C

CircRNA UID

circGPRC5C(2,3)

Open Reading Frame (ORF)

LPRVCLCGEARLLHLCLSALPLWGSVRHLLLLSGGSRLCPQLPGPEEPRAPGLGDLHCGSAADPGRGHHQYRVADHHPGSGQWRGRPSGQQQRRLGRGLPLCHRQHGLCHGTHLRHAAAAGCLPGGLARPVWPLQALA

Peptide

APGLGDLHCGSAADPGR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page