top of page

CircRNA

Gene

chr17|67874816|67894165|+|5|circRNA|BPTF|ENST00000544778.6|4,5,6,7,8

BPTF

Open Reading Frame (ORF)

MCSKPREFALALAILECAVKPVVMLPIWRESLGHTRRNFGIHKSQKGRH

Peptide

ESLGHTRR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page