top of page

CircRNA

Gene

chr17|64561499|64571956|-|3|circRNA|SMURF2|ENST00000582081.5|12,11,10

SMURF2

CircRNA UID

circSMURF2(12,11,10)

Open Reading Frame (ORF)

LTMEALPGILATSIVKSLVHCLLDGRSVIRQQAEFISLTITTEQHNLQILGCLLTCI

Peptide

LTMEALPGILATSIVK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page