top of page

CircRNA

Gene

chr17|64354932|64363397|-|4|circRNA|PECAM1|ENST00000563924.5|9,8,7,6

PECAM1

Open Reading Frame (ORF)

LLHPRSTSSQLHHPEGRYDCVTDSRFHQDSLKVGQWDVYLHCRY

Peptide

FHQDSLK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page