top of page

CircRNA

Gene

chr17|63099174|63200957|+|3|circRNA|TANC2|NM_025185|3,4,5

TANC2

Open Reading Frame (ORF)

LPLHQPVAPALHSHPSVQMQLPRTAAMGLLLVQPLPLKAEIVASLVASPQKATVLLSQTTLSRHFQ

Peptide

AEIVASLVASPQK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page