top of page

CircRNA

Gene

chr17|61992539|62052705|-|9|circRNA|MED13|ENST00000397786.6|11,10,9,8,7,6,5,4,3

MED13

CircRNA UID

circMED13(11,10,9,8,7,6,5,4,3)

Open Reading Frame (ORF)

MKKMLCHYLVPLSSKKKKMECGRMDFPMNAVLCFSKQFTIYWNGV

Peptide

MDFPMNAVLCFSKQFTIYWNGV

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page