top of page

CircRNA

Gene

chr17|61950824|61985090|-|16|circRNA|MED13|ENST00000397786.6|28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13

MED13

CircRNA UID

circMED13(28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13)

Open Reading Frame (ORF)

LIGYYQQNLMRKYLIFFSNHWPLVTLYQLPKQVHYLTGSGQHVLKHNISVPFFLSLDLKNQQMDQMIKPAARNQRQEIWTRYLA

Peptide

NQQMDQMIKPAARNQR

ORF Found in Long-Read

true

Peptide Length

16

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page