top of page

CircRNA

Gene

chr17|59682628|59685808|+|8|circRNA|CLTC|ENST00000621829.4|23,24,25,26,27,28,29,30

CLTC

Open Reading Frame (ORF)

MQCSMLLNLKILNWLKNSCSGFCRKKKESALELVCLPVTIF

Peptide

NSCSGFCRK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page