top of page

CircRNA

Gene

chr17|58505471|58506871|-|2|circRNA|MTMR4|ENST00000579925.5|11,10

MTMR4

Open Reading Frame (ORF)

MGMANIHAIRNSFQYLRAVCSQMPDPSKFFSDCVLWSGEHSSSSKAADPGCAILHGSSGQPGQGWRL

Peptide

AADPGCAILHGSSGQPGQGWR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page