top of page

CircRNA

Gene

chr17|51201591|51217416|-|7|circRNA|MBTD1|ENST00000586178.5|12,11,10,9,8,7,6

MBTD1

Open Reading Frame (ORF)

MKLEAIDPLNLSTICVATIRKQSPWKVSAGVTTSIAIAL

Peptide

VSAGVTTSIAIAL

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page