top of page

CircRNA

Gene

chr17|50979745|50987237|—|5|circRNA|SPAG9|NM_001251971|22,21,20,19,18

SPAG9

Open Reading Frame (ORF)

LMHIPGRRAKCDSLRGWGMACGSPFAWILRSVSIMHTLINIYRMWTLSLM

Peptide

LMHIPGR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page